Yahoo India Web Search

Search results

1. Dictionary

   chalky

   /ˈtʃɔːki/

   adjective

   • 1. consisting of or rich in chalk: "chalky soil"
   • 2. resembling chalk in texture or paleness of colour: "walls of chalky green" Similar palebloodlesspallidcolourlesswanashenwhitewaxenchalk whitemilkypastypasty-facedwhey-facedpeakysicklyanaemictired-lookingwashed outsallowdraineddrawnsappedghostlydeathlydeathlikeblanchedbleachedrare:etiolatedpowderyflourymealydustygrittycrumblyfriablegranulatedgranulargroundcrushedpulverizedrare:pulverulentlevigatedOpposite rosyflushedsmooth

   Derivatives

   • 1. chalkiness noun

   Scrabble Points: 18

   • C

     3

   • H

     4

   • A

     1

   • L

     1

   • K

     5

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What is the adjective for chalky?

   • CHALKY. • CHALKY (adjective) The adjective CHALKY has 2 senses: 1. composed of or containing or resembling calcium carbonate or calcite or chalk 2. of something having the color of chalk Familiarity information: CHALKY used as an adjective is rare.

   What does chalky mean? definition and meaning (Free

   www.audioenglish.org/dictionary/chalky.htm

   See all results for this question

   What is the meaning of chalk?

   • 1. To mark, draw, or write with chalk: chalked my name on the blackboard. 2. To rub or cover with chalk, as the tip of a billiard cue. 3. To make pale; whiten. 4. To treat (soil, for example) with chalk.

   Chalky - definition of chalky by The Free Dictionary

   www.thefreedictionary.com/chalky

   See all results for this question

   What does Chalkie mean?

   • Chalkie or Chalkdust, nickname of Hollis Liverpool (born 1940), Trinidadian calypsonian and scholar Chalkie White (disambiguation), a list of people and fictional characters nicknamed "Chalkie White" or "Chalky White" Chalkie, a tyrannical teacher character created by cartoonist Carl Giles

   Chalky - Wikipedia

   en.wikipedia.org/wiki/Chalky

   See all results for this question

   What does chalk mean in a sentence?

   • Spelling Bee Quiz Can you outdo past winners of the National Spelli... The meaning of CHALK is a soft white, gray, or buff limestone composed chiefly of the shells of foraminifers. How to use chalk in a sentence.

   Chalky Definition & Meaning - Merriam-Webster

   www.merriam-webster.com/dictionary/chalky

   See all results for this question

   What does chalk paint look like?

   • Of, containing, or covered with chalk. Like chalk in color; dull white. Other paints are so matt that the finish looks almost chalky. Therein two eggs, with white, chalky shells, are commonly laid. The first signs of damage are chalky white spots or lines across the teeth.

   Chalky Meaning | Best 5 Definitions of Chalky

   www.yourdictionary.com/chalky

   See all results for this question

   What does a chalky ring on a cliff mean?

   • A chalky ring on the surrounding cliffs marked where the waterline once reached, like the residue on an empty bathtub. These products have found huge popularity among women of color who are thrilled to have moisturizers that don’t leave them looking chalky or too shiny and protect them from the sun’s rays.

   CHALKY Definition & Meaning | Dictionary.com

   www.dictionary.com/browse/chalky

   See all results for this question

3. dictionary.cambridge.org › dictionary › englishCHALKY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   Chalky means containing or similar to chalk, a soft white rock. Learn how to use this adjective with sentences and translations in different languages.

   • English (US)

     CHALKY meaning: 1. containing or similar to chalk (= soft...

   • Znaczenie Chalky, Definicja W Cambridge English Dictionary

     chalky definicja: 1. containing or similar to chalk (= soft...

   • Chalky: German Translation

     CHALKY translate: kreidig, kreidebleich. Learn more in the...

4. www.dictionary.com › browse › chalkyCHALKY Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › chalky

   • Cached

   adjective. , chalk·i·er, chalk·i·est. of or like chalk. of a chalklike consistency: chalky soil. without resonance, color, warmth, etc.: several high tones that were quite chalky. Photography. lacking in detail, due to extreme contrast: a chalky print. Sports Slang. relating to the competitor considered most likely to win by the oddsmakers:

5. www.merriam-webster.com › dictionary › chalkyChalky Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › chalky

   • Cached

   Learn the meaning of chalk as a noun and a verb, with examples of usage and etymology. Find out how to say chalk in different languages and play word games related to chalk.

6. www.collinsdictionary.com › dictionary › englishCHALKY definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   Chalky means containing, covered with, or resembling chalk. It can also describe a pale dull colour or a powdery texture. See how to use chalky in sentences and find related words.

7. www.vocabulary.com › dictionary › chalkyChalky - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › chalky

   Definitions of chalky. adjective. composed of or containing or resembling calcium carbonate or calcite or chalk. synonyms: calcareous. adjective. of something having the color of chalk. “she turned chalky white”. synonyms: achromatic, neutral.

8. www.thefreedictionary.com › chalkyChalky - definition of chalky by The Free Dictionary

   www.thefreedictionary.com › chalky

   • Cached

   Chalky means composed of or containing or resembling calcium carbonate or chalk. It can also describe something having the color of chalk or pale. See synonyms, translations and usage examples of chalky.

9. www.yourdictionary.com › chalkyChalky Definition & Meaning | YourDictionary

   www.yourdictionary.com › chalky

   • Cached

   Chalky Sentence Examples. Other paints are so matt that the finish looks almost chalky. Therein two eggs, with white, chalky shells, are commonly laid. The first signs of damage are chalky white spots or lines across the teeth.