Yahoo India Web Search

Search results

1. Dictionary

   amplify

   /ˈamplɪfʌɪ/

   verb

   • 1. increase the volume of (sound), especially using an amplifier: "the accompanying chords have been amplified in our arrangement" Similar loudenmake louderturn upincreasebooststep upraisemagnifyintensifyescalateswellheightenadd toaugmentsupplementOpposite reducequieten
   • ▪ increase the amplitude of (an electrical signal or other oscillation): "the manufacturers have developed a system of amplifying the radio signal"
   • ▪ make (something) more marked or intense: "urban policy initiatives amplified social polarization"
   • 2. enlarge upon or add detail to (a story or statement): "the notes amplify information contained in the statement" Similar expandenlarge onelaborate onadd todevelopflesh outadd flesh toadd detail togo into detail aboutembroidersupplementaugmentreinforceOpposite condense
   • 3. make multiple copies of (a gene or DNA sequence): "genomic DNA was amplified using the polymerase chain reaction"

   Word Origin late Middle English (in the general sense ‘increase, augment’): from Old French amplifier, from Latin amplificare, from amplus ‘large, abundant’.

   Scrabble Points: 17

   • A

     1

   • M

     3

   • P

     3

   • L

     1

   • I

     1

   • F

     4

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What does it mean to amplify a sentence?

   • When referring to writing, amplification means that the writer has added additional details to a sentence in order to make the idea more clear and understandable. In other words, the writer has added additional description to make the meaning more clear. For instance, instead of saying 'The movie was boring', an amplified version could be 'The movie was disappointingly dull, with unengaging characters and a predictable plot'. The original sentence did not provide much context, while the amplified version offers more details that help the reader better understand the writer's perspective.

   Amplification Examples - Softschools.com

   www.softschools.com/examples/literary_terms/amplification_examples/679/

   See all results for this question

   What does a funeral amplify?

   • A funeral can amplify the feelings of regret and loss for the relatives. You can also find related words, phrases, and synonyms in the topics: Electric guitars are amplified through loudspeakers. This study amplifies earlier research.

   AMPLIFY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org/dictionary/english/amplify

   See all results for this question

   What does amplify mean?

   • amplificar, aprofundar… Need a translator? Get a quick, free translation! AMPLIFY definition: 1. to make something louder: 2. to increase the size or effect of something: 3. to make something…. Learn more.

   AMPLIFY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org/dictionary/english/amplify

   See all results for this question

   What does an amplifier mean?

   • An amplifier is an electronic device that increases the strength of a signal. It can also be defined as a person or device that amplifies or enlarges (from The Free Dictionary definition).

   Amplifiers - definition of Amplifiers by The Free Dictionary

   www.thefreedictionary.com/amplifiers

   See all results for this question

3. dictionary.cambridge.org › dictionary › englishAMPLIFY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   AMPLIFY definition: 1. to make something louder: 2. to increase the size or effect of something: 3. to make something…. Learn more.

   • English (US)

     AMPLIFY meaning: 1. to make something louder: 2. to increase...

   • Znaczenie Amplify, Definicja W Cambridge English Dictionary

     AMPLIFY definicja: 1. to make something louder: 2. to...

   • Amplify: Arabic Translation

     AMPLIFY translate: يُكبِّر الصوت. Learn more in the...

   • Amplify: German Translation

     AMPLIFY translate: erweitern, verstärken. Learn more in the...

   • Amplify in Russian

     AMPLIFY translate: усиливать , усиливать. Learn more in the...

   • Amplify: Czech Translation

     amplify - translate into Czech with the English-Czech...

   • Amplify: Polish Translation

     AMPLIFY translate: wzmacniać, podkreślać, wzmacniać,...

   • Amplify: Catalan Translation

     AMPLIFY translate: amplificar. Learn more in the Cambridge...

4. www.merriam-webster.com › dictionary › amplifyAmplify Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › amplify

   • Cached

   The meaning of AMPLIFY is to expand (something, such as a statement) by the use of detail or illustration or by closer analysis. How to use amplify in a sentence. Synonym Discussion of Amplify.

5. dictionary.cambridge.org › english › amplifyAMPLIFY | definition in the Cambridge English Dictionary

   dictionary.cambridge.org › english › amplify

   • Cached

   AMPLIFY meaning: 1. to make something louder: 2. to increase the size or effect of something: 3. to make something…. Learn more.

6. Videos

   • 

     2:48

     youtube.com

     Class 12th – Definitions - Amplification | Communication | Tutorials Point

     4 Jan 2018

     35.4K views

   • 

     3:16

     youtube.com

     Amplifier basics, Types & Characteristics | Basics of Electronics

     6 Aug 2021

     79.5K views

   • 

     50:52

     youtube.com

     Amplify Reading: What Makes It Different? | Amplify

     27 Jul 2020

     7.3K views

   View all

7. www.dictionary.com › browse › amplifyAMPLIFY Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › amplify

   • Cached

   Amplify definition: to make larger, greater, or stronger; enlarge; extend.. See examples of AMPLIFY used in a sentence.

8. www.vocabulary.com › dictionary › amplifyAmplify - Definition, Meaning & Synonyms - Vocabulary.com

   www.vocabulary.com › dictionary › amplify

   The verb amplify means to crank up the volume. Speakers amplify, or raise, the volume of the noise coming through a microphone so that everyone at the rock show can hear.

9. www.thefreedictionary.com › amplifyAmplify - definition of amplify by The Free Dictionary

   www.thefreedictionary.com › amplify

   • Cached

   1. to make larger, greater, or stronger; enlarge; extend. 2. to expand in stating or describing, as by details or illustrations; clarify by expanding. 3. a. to increase the amplitude of; cause amplification in.

10. www.collinsdictionary.com › dictionary › englishAMPLIFY definition and meaning | Collins English Dictionary

    www.collinsdictionary.com › dictionary › english

    • Cached

    To amplify something means to increase its strength or intensity. The mist had been replaced by a kind of haze that seemed to amplify the heat. [VERB noun] Her anxiety about the world was amplifying her personal fears about her future. [VERB noun] amplification uncountable noun.