Yahoo India Web Search

Search results

1. Dictionary

   want

   /wɒnt/

   verb

   • 1. have a desire to possess or do (something); wish for: "I want an apple" Similar desirewish forhope forfancyhave a fancy fortake a fancy tohave an inclination forcare forlikeset one's heart onlong foryearn forpine forsigh forcravehanker afterhunger forthirst forlust aftercry out forbe desperate foritch forcovetneedbe bent oninformal:have a yen forbe dying for
   • ▪ wish to speak to (someone): "Tony wants me in the studio"
   • ▪ (of a suspected criminal) be sought by the police for questioning: "he is wanted by the police in connection with an arms theft"
   • ▪ desire (someone) sexually: "I've wanted you since the first moment I saw you"
   • ▪ desire to be in or out of a particular place or situation: informal North American "if anyone wants out, there's the door"
   • 2. should or need to do something: informal "you don't want to believe everything you hear" Similar shouldoughtneedmust
   • ▪ (of a thing) require to be attended to in a specified way: British "the wheel wants greasing" Similar needbe/stand in need ofrequiredemandcry out for
   • 3. lack something desirable or essential: literary "you shall want for nothing while you are with me"
   • ▪ (chiefly used in expressions of time) lack or be short of (a specified amount or thing): archaic "it wanted twenty minutes to midnight"

   noun

   • 1. a lack or deficiency of something: "Victorian houses which are in want of repair" Similar lackabsencenon-existenceunavailabilitydearthdeficiencyinadequacyinsufficiencypaucityshortageshortfallshortnessscarcityscarcenessscantinessundersupplydeficitrare:exiguityOpposite abundancepresence
   • ▪ the state of being poor and in need of essentials; poverty: "freedom from want" Similar needneedinessausterityprivationdeprivationpovertyimpoverishmentimpecuniousnessimpecuniositypennilessnesspauperismpenurydestitutionfaminedroughtindigenceOpposite wealthplenty
   • 2. a desire for something: "the expression of our wants and desires" Similar wishdesiredemandlongingyearningfancycravinghankeringneedrequirementnecessityessentialrequisiteinformal:yen

   Word Origin Middle English: the noun from Old Norse vant, neuter of vanr ‘lacking’; the verb from Old Norse vanta‘be lacking’. The original notion of ‘lack’ was early extended to ‘need’ and from this developed the sense ‘desire’.

   Derivatives

   • 1. wanter noun

   Scrabble Points: 7

   • W

     4

   • A

     1

   • N

     1

   • T

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.vocabulary.com › dictionary › word finderWord finder - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › word finder

   2 days ago · /wərd ˌfaɪndər/ /wəd ˈfaɪndə/ IPA guide. Definitions of word finder. noun. a thesaurus organized to help you find the word you want but cannot think of. synonyms: wordfinder. see more. Cite this entry. Style: MLA. "Word finder." Vocabulary.com Dictionary, Vocabulary.com, https://www.vocabulary.com/dictionary/word finder. Accessed 02 Jul. 2024.

3. www.geeksforgeeks.org › how-to-plot-user-definedHow to plot user-defined functions in R? - GeeksforGeeks

   www.geeksforgeeks.org › how-to-plot-user-defined

   • Cached

   3 days ago · Step 1: Define the Function. We can define the custom function in R. For example, the simple quadratic function. R. # Define the quadratic function quadratic <- function(x) { return(x^2 + 2*x + 1) } Step 2. Generate a Sequence of Input Values. Next, generate a sequence of input values over which you want to plot the function.

4. stackoverflow.com › questions › 78701396define an array in c using a macro as length in C - Stack ...

   stackoverflow.com › questions › 78701396

   • Cached

   5 days ago · 1. This question was migrated from Unix & Linux Stack Exchange because it can be answered on Stack Overflow. Migrated yesterday . I want to defined an array, the length from a macro as below, #define A (2.5) #define B (2.0) #define LEN (A*B) // I know LEN is an integer, not decimal numbers. static int array[LEN] // define an integer array ...

5. en.wikipedia.org › wiki › MeditationMeditation - Wikipedia

   en.wikipedia.org › wiki › Meditation

   • Cached

   1 day ago · There is no universally accepted definition. Theories and practices differ within traditions, with some emphasizing the inseparability of meditation from their cultural and religious contexts, while others focus on its role in achieving a relaxed or devout state.

6. community.atlassian.com › t5 › Jira-ServiceHow to define Customer comment SLA - Atlassian Community

   community.atlassian.com › t5 › Jira-Service

   • Cached

   1 day ago · How to define Customer comment SLA. How to define Customer comment SLA. Ran Wronsky July 7, 2024 edited. Hello, I have a project in which want to set 2 SLAs. The first is simple for first response on a ticket and is time based, using creation and exit criteria is entering status which does the job great. The other is a bit more challenging to do:

7. www.britannica.com › topic › educationEducation | Definition, Development, History, Types, & Facts

   www.britannica.com › topic › education

   • Cached

   5 days ago · What does education mean? What was education like in ancient Athens? How does social class affect education attainment? When did education become compulsory? What are alternative forms of education?

8. www.washingtonpost.com › world › 2024/07/07What to know about France’s leftist alliance after shock ...

   www.washingtonpost.com › world › 2024/07/07

   • Cached

   8 hours ago · The New Popular Front wants to lower France’s retirement age and vastly expand government spending on social welfare, environmental protection and health care.