Yahoo India Web Search

Search results

1. Dictionary

   aching

   /ˈeɪkɪŋ/

   adjective

   • 1. having an ache in a part of one's body: "the cool air was a relief to my aching head" Similar painfulachysorestiffhurttenderuncomfortabletroublesomehurtingin painthrobbingpoundingtwingeingsmartinggnawingburningtinglingstingingagonizingsearingfeeling tenderfeeling uncomfortablegiving someone troubleinformal:killingplaying someone upgiving someone gyp
   • 2. arousing, experiencing, or expressive of intense sorrow or longing: "I write this letter with tears in my eyes and an aching heart" Similar sorrowfulsadmournfulmiserableupsetdistressedanguishedheavy with griefgrief-strickenwretchedheavygrievingsorrowingmourninglamentingin distressin anguishsufferingbleedingOpposite cheerfullight

   Scrabble Points: 12

   • A

     1

   • C

     3

   • H

     4

   • I

     1

   • N

     1

   • G

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What does acute pain mean?

   • In the general sense, acute pain means pain that decreases or stops when the disease improves. ^ Doctors define acute pain as pain associated with a cause that can be relieved by treating the cause.

   Chronic pain - Wikipedia

   en.wikipedia.org/wiki/Chronic_pain

   See all results for this question

   What does pain feel like?

   • Pain is a distressing feeling often caused by intense or damaging stimuli. The International Association for the Study of Pain defines pain as "an unpleasant sensory and emotional experience associated with, or resembling that associated with, actual or potential tissue damage."

   Pain - Wikipedia

   en.wikipedia.org/wiki/Pain

   See all results for this question

   Why is pain a symptom of a medical condition?

   • Pain is a symptom of many medical conditions. Knowing the time of onset, location, intensity, pattern of occurrence (continuous, intermittent, etc.), exacerbating and relieving factors, and quality (burning, sharp, etc.) of the pain will help the examining physician to accurately diagnose the problem.

   Pain - Wikipedia

   en.wikipedia.org/wiki/Pain

   See all results for this question

   Is pain aversive?

   • Harold Merskey 2000 Although pain is considered to be aversive and unpleasant and is therefore usually avoided, a meta-analysis which summarized and evaluated numerous studies from various psychological disciplines, found a reduction in negative affect.

   Pain - Wikipedia

   en.wikipedia.org/wiki/Pain

   See all results for this question

3. en.wikipedia.org › wiki › PainPain - Wikipedia

   en.wikipedia.org › wiki › Pain

   • Cached

   5 days ago · Pain - Wikipedia. Pain is a distressing feeling often caused by intense or damaging stimuli. The International Association for the Study of Pain defines pain as "an unpleasant sensory and emotional experience associated with, or resembling that associated with, actual or potential tissue damage." [1]

4. www.vocabulary.com › dictionary › hurtingHurting - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › hurting

   2 days ago · Definitions of hurting. noun. a symptom of some physical hurt or disorder. synonyms: pain. see more.

5. www.healthline.com › health › burning-sensationBurning Sensation: Causes, Conditions, and Treatment - Healthline

   www.healthline.com › health › burning-sensation

   • Cached

   3 days ago · A burning sensation is a type of pain that’s distinct from dull, stabbing, or aching pain. Learn some possible causes of a burning sensation.

   • Author: Mary Ellen Ellis

6. en.wikipedia.org › wiki › Chronic_painChronic pain - Wikipedia

   en.wikipedia.org › wiki › Chronic_pain

   • Cached

   6 days ago · The International Association for the Study of Pain (IASP) defines chronic pain as a general pain without biological value that sometimes continues even after the healing of the affected area; A type of pain that cannot be classified as acute pain and lasts longer than expected to heal, or typically, pain that has been experienced on most days ...

7. www.healthline.com › health › allodyniaAllodynia: What Is It, Symptoms, Causes, Treatment, and More

   www.healthline.com › health › allodynia

   • Cached

   If you feel pain from stimuli that don't usually cause pain, you might have allodynia. Learn how to treat it.

8. www.nature.com › subjects › painPain - Latest research and news | Nature

   www.nature.com › subjects › pain

   5 days ago · Definition. Pain is an unpleasant sensory and emotional experience. Acute nociceptive pain is induced by noxious stimuli, and is often a result of an intense or potentially damaging...

9. thejournalofheadacheandpain.biomedcentral.comPersistent effectiveness of CGRP antibody therapy in migraine ...

   thejournalofheadacheandpain.biomedcentral.com

   • Cached

   3 days ago · Background Management of patients with migraine who have concomitant medication overuse (MO) or medication overuse headache (MOH) is a major problem in clinical practice. Detoxification of acute analgesics before or during initiation of prophylactic therapy has long been recommended although this concept has recently been questioned. Additionally, relapse after detoxification is a common problem. This real-world study analyses the initial and sustained effectiveness of prophylactic migraine ...