Yahoo India Web Search

Search results

1. Dictionary

   fussy

   /ˈfʌsi/

   adjective

   • 1. fastidious about one's needs or requirements; hard to please: "he is very fussy about what he eats" Similar finickyparticularover-particularfastidiousdiscriminatingselectivedaintypunctilioushard to pleasedifficultexactingdemandinginformal:choosypickynitpickingold womanishold maidishpernicketyfaddishfaddypersnicketyarchaic:niceovernicerare:finicalOpposite easy to pleaseindiscriminate
   • 2. full of unnecessary detail or decoration: "she describes her own style as elegant chic, simple not fussy" Similar over-elaborateover-embellishedoverdecoratedover-ornateoverdoneoverworkedbusyclutteredlabouredstrainedfloridornatefancyOpposite understated
   • ▪ showing excessive or anxious concern about detail: "Eleanor patted her hair with quick, fussy movements"
   • 3. (of a baby or infant) prone to crying or being upset; irritable: "the rocker has a calming vibration setting that helps soothe fussy babies"

   Derivatives

   • 1. fussily adverb
   • 2. fussiness noun

   Scrabble Points: 11

   • F

     4

   • U

     1

   • S

     1

   • S

     1

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What is fussy cutting?

   • Ashley Hough demonstrates how to use a term known as fussy cutting to do both of those things. In general, the term fussy cutting means to be “fussy” or particular in how you cut out a piece of fabric. This technique is most commonly used to highlight a fun design or motif on a piece of fabric as opposed to using a large piece of that fabric.

   Fussy Cutting: Tips and Techniques | National Sewing Circle

   www.nationalsewingcircle.com/video/fussy-cutting-015654/

   See all results for this question

   What is a typical baby fussy?

   • While there is a wide range of typical infant fussiness, here is a guide to knowing the difference between typical baby fussiness and what is not. Babies cry—a lot! Even happy, healthy babies cry. Healthy infants typically follow a crying curve, which gradually increases from birth until five to six weeks old.

   Baby Fussiness: When It’s Normal and When It’s Not

   www.baby-chick.com/baby-fussiness-when-its-normal-and-when-its-not/

   See all results for this question

   How do you use fussy cutting?

   • Fussy cutting can also be used when cutting out pattern pieces for a garment. Similar to some tips for sewing directional fabric, laying out the pattern piece before cutting is very important. Ashley show several examples of fabric that can be used for this technique and shows where they would be both good and not good to use.

   Fussy Cutting: Tips and Techniques | National Sewing Circle

   www.nationalsewingcircle.com/video/fussy-cutting-015654/

   See all results for this question

3. www.vocabulary.com › dictionary › fussilyFussily - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › fussily

   Jun 14, 2024 · adverb. in a fussy manner. “he spoke to her fussily ” Cite this entry. Style: MLA. "Fussily." Vocabulary.com Dictionary, Vocabulary.com, https://www.vocabulary.com/dictionary/fussily. Accessed 14 Jun. 2024. Copy citation. VocabTrainer™. 2 million people have mastered 403,925,132 new words. Master your first word today! Start Now.

4. www.baby-chick.com › baby-fussiness-when-itsBaby Fussiness: When It’s Normal and When It’s Not

   www.baby-chick.com › baby-fussiness-when-its

   • Cached

   Jul 2, 2024 · In addition to learning your baby’s specific cries and needs, you may be wondering if your baby’s fussiness is within the realm of normal. While there is a wide range of typical infant fussiness, here is a guide to knowing the difference between typical baby fussiness and what is not.

5. Videos

   • 

     5:33

     youtube.com

     🔵 Fuss Fussy Fusspot - Fuss Meaning - Fuss Examples - Fussy Defined - English Vocabulary

     18 Mar 2021

     4.7K views

   • 

     0:29

     youtube.com

     Fussy Meaning

     14 Apr 2015

     31.9K views

   • 

     1:02

     youtube.com

     Fussy — what is FUSSY definition

     3 Apr 2023

     1.1K views

   View all

6. www.nationalsewingcircle.com › video › fussy-cuttingFussy Cutting: Tips and Techniques | National Sewing Circle

   www.nationalsewingcircle.com › video › fussy-cutting

   • Cached

   Jul 4, 2024 · In general, the term fussy cutting means to be “fussy” or particular in how you cut out a piece of fabric. This technique is most commonly used to highlight a fun design or motif on a piece of fabric as opposed to using a large piece of that fabric.

7. www.newhealthadvisor.org › fuzzy-head-blurredWhat Causes Fuzzy Head and Blurry Vision? | New Health Advisor

   www.newhealthadvisor.org › fuzzy-head-blurred

   • Cached

   2 days ago · Why Do I Have Fuzzy Head and Blurred Vision? Not knowing what causes fuzzy head and blurred vision can be upsetting. Especially if you have never experienced anything like this before. Here are a few of the common causes and some not-so-common causes: 1. Wernicke-Korsakoff Syndrome. This syndrome is caused by a vitamin B-1 deficiency.

8. www.momjunction.com › articles › characteristics10 Characteristics Of High Needs Baby & Ways To Handle It

   www.momjunction.com › articles › characteristics

   • Cached

   Jun 27, 2024 · A high need baby is often fussy, demanding, and difficult to make happy. Learn the signs of a high need baby and ways to deal with the high need behavior.

   • Author: Rohit Garoo

   • 
   • 
   • 
   • 

9. www.pnut.com.au › how-to-keep-fussy-kids-satisfiedHow to Keep Fussy Kids Satisfied at Home: Tips from P'Nut ...

   www.pnut.com.au › how-to-keep-fussy-kids-satisfied

   • Cached

   2 days ago · Absolutely, getting kids to eat healthily can be quite a challenge, especially with fussy eaters who seem to develop new food aversions frequently. At P'Nut Asian Kitchen, we understand the struggle and believe that with a little creativity and the right approach, mealtime can be an enjoyable experience for the whole family.

10. www.youtube.com › watchWhy we don't say "fussy" - YouTube

    www.youtube.com › watch

    • Cached

    Jul 1, 2024 · We stopped using the word “fussy” and requested that our close family did as well and it has made a huge positive shift. Also sharing what we say instead!#tw...

    • Video Duration: 3 min

    • Author: Jess Campbell | Twin Mama