Yahoo India Web Search

Search results

1. Dictionary

   forward

   /ˈfɔːwəd/

   adverb

   • 1. in the direction that one is facing or travelling; towards the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or towards the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backwards as forwards"
   • 2. onward so as to make progress: "the signing of the treaty is a big step forward" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar towards the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. towards the future; ahead in time: "looking forward, earnings are expected to hit £7.2 billion" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to November"

   adjective

   • 1. directed or facing towards the front or the direction that one is facing or travelling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or towards the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. progressing towards a successful conclusion: "the decision is a forward step"
   • ▪ further advanced than expected or required: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or overfamiliar in manner: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in football, hockey, or other sports.
   • 2. agreements to trade specified assets, typically currency, at a specified price at a certain future date.

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavoursupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. dictionary.cambridge.org › dictionary › englishFORWARD | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   Learn the meaning of forward as an adverb, adjective, verb and noun in English. See how to use forward in different contexts, such as direction, future, progress, sports and business.

3. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   Learn the various meanings and uses of the word forward as an adjective, adverb, verb, and noun. See synonyms, examples, word history, and related phrases of forward.

4. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   Forward means in a position near the front of something such as a building or a vehicle. The best seats are in the aisle and as far forward as possible. The other car had a 3-inch lower driving seat and had its engine mounted further forward. Forward is also an adjective. Reinforcements were needed to allow more troops to move to forward positions.

5. www.dictionary.com › browse › forwardFORWARD Definition & Meaning - Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

6. www.vocabulary.com › dictionary › forwardForward - Definition, Meaning & Synonyms - Vocabulary.com

   www.vocabulary.com › dictionary › forward

   Forward can be a direction of either space or time, and also implies progress. A forward-thinking person thinks about what will happen in the future. If you forward an email, you send it on to a new recipient. But if you forward a cause, that means you helped propel it to success.

7. www.oxfordlearnersdictionaries.com › definition › englishforward adverb - Definition, pictures, pronunciation and usage...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   Learn the meaning, pronunciation and examples of the adverb forward, which can indicate direction, time, result or position. Find out how to use forward in phrasal verbs, idioms and collocations.

8. www.thefreedictionary.com › forwardForward - definition of forward by The Free Dictionary

   www.thefreedictionary.com › forward

   • Cached

   a. Being ahead of current economic, political, or technological trends; progressive: a forward concept. b. Deviating radically from convention or tradition; extreme. 5. Exceptionally advanced; precocious. 6. Of, relating to, or done in preparation for the future: a rise in the forward price of corn. adv. or for·wards (-wərdz) 1.

9. www.oxfordlearnersdictionaries.com › definition › englishforward adjective - Definition, pictures, pronunciation and usage...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   Learn the meaning, pronunciation and usage of the word forward as an adjective. Find out how to use it to describe direction, location, time, attitude and more.

10. dictionary.cambridge.org › dictionary › learner-englishFORWARD | meaning - Cambridge Learner's Dictionary - Cambridge ...

    dictionary.cambridge.org › dictionary › learner-english

    • Cached

    Learn the meaning of forward as an adverb, adjective, verb and noun in English. See how to use forward in different contexts, such as direction, future, progress and sports.

11. www.oxfordlearnersdictionaries.com › definition › american_englishforward adverb - Definition, pictures, pronunciation and usage...

    www.oxfordlearnersdictionaries.com › definition › american_english

    • Cached

    Learn the meaning and usage of the adverb forward, which can indicate direction, result, time, or position. See pictures, pronunciation, idioms, and synonyms of forward.